Lineage for d7icoa3 (7ico A:92-148)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494216Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1494217Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1494218Protein DNA polymerase beta [81579] (2 species)
  7. 1494219Species Human (Homo sapiens) [TaxId:9606] [81575] (143 PDB entries)
  8. 1494343Domain d7icoa3: 7ico A:92-148 [76020]
    Other proteins in same PDB: d7icoa1, d7icoa4
    protein/DNA complex; complexed with na, zn

Details for d7icoa3

PDB Entry: 7ico (more details), 3.3 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex, soaked in the presence of zncl2
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d7icoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7icoa3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOPe Domain Coordinates for d7icoa3:

Click to download the PDB-style file with coordinates for d7icoa3.
(The format of our PDB-style files is described here.)

Timeline for d7icoa3: