Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) |
Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins) insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain |
Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [81574] (107 PDB entries) Uniprot P06746 |
Domain d7icea4: 7ice A:149-335 [76001] Other proteins in same PDB: d7icea1, d7icea3 protein/DNA complex; complexed with na |
PDB Entry: 7ice (more details), 2.8 Å
SCOPe Domain Sequences for d7icea4:
Sequence; same for both SEQRES and ATOM records: (download)
>d7icea4 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]} ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr epkdrse
Timeline for d7icea4: