SCOPe 2.06: Domain d1l5aa2: 1l5a A:175-424

Lineage for d1l5aa2 (1l5a A:175-424)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.2: NRPS condensation domain (amide synthase) [75229] (2 proteins)
   Pfam PF00668; functional domain of multifunctional enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein VibH [75230] (1 species)
   relative spatial position of the domains is similar to the monomers in CAT trimer

7. Species Vibrio cholerae [TaxId:666] [75231] (1 PDB entry)

8. Domain d1l5aa2: 1l5a A:175-424 [75924]

Details for d1l5aa2

PDB Entry: 1l5a, 2.55 Å

PDB Description: Crystal Structure of VibH, an NRPS Condensation Enzyme

PDB Compounds: (A:) amide synthase

SCOPe Domain Sequences for d1l5aa2:

Sequence; same for both SEQRES and ATOM records:

>d1l5aa2 c.43.1.2 (A:175-424) VibH {Vibrio cholerae [TaxId: 666]}
hrywqdkqfwqgylreapdltltsatydpqlshavslsytlnsqlnhlllklananqigw
pdalvalcalylesaepdapwlwlpfmnrwgsvaanvpglmvnslpllrlsaqqtslgny
lkqsgqairslylhgryrieqieqdqglnaeqsyfmspfinilpfesphfadcqtelkvl
asgsaeginftfrgspqhelclditadlasypqshwqshcerfprffeqllarfqqveqd
varllaepaa

Timeline for d1l5aa2:

• d1l5aa2 first appeared in SCOP 1.63
  
• d1l5aa2 appears in SCOPe 2.05
  
• d1l5aa2 appears in SCOPe 2.07
  
• d1l5aa2 appears in the current release, SCOPe 2.08