Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) |
Family c.43.1.2: NRPS condensation domain (amide synthase) [75229] (2 proteins) Pfam PF00668; functional domain of multifunctional enzyme containing tandem repeat of two CAT subunit-like domains |
Protein VibH [75230] (1 species) relative spatial position of the domains is similar to the monomers in CAT trimer |
Species Vibrio cholerae [TaxId:666] [75231] (1 PDB entry) |
Domain d1l5aa1: 1l5a A:1-174 [75923] |
PDB Entry: 1l5a (more details), 2.55 Å
SCOPe Domain Sequences for d1l5aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5aa1 c.43.1.2 (A:1-174) VibH {Vibrio cholerae [TaxId: 666]} mllaqkpfwqrhlayphinldtvahslrltgpldttlllralhltvseidlfrarfsaqg elywhpfsppidyqdlsihleaeplawrqieqdlqrsstlidapitshqvyrlshsehli ytrahhivldgygmmlfeqrlsqhyqsllsgqtptaafkpyqsyleeeaaylts
Timeline for d1l5aa1:
View in 3D Domains from other chains: (mouse over for more information) d1l5ab1, d1l5ab2, d1l5ac1, d1l5ac2 |