Lineage for d1l2da2 (1l2d A:2-134)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382622Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 382623Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 382624Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (2 proteins)
  6. 382625Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 382626Species Bacillus stearothermophilus [TaxId:1422] [81612] (7 PDB entries)
  8. 382630Domain d1l2da2: 1l2d A:2-134 [75921]
    Other proteins in same PDB: d1l2da1, d1l2da3
    DNA estranged guanine mismatch recognition complex
    complexed with hpd, zn

Details for d1l2da2

PDB Entry: 1l2d (more details), 2 Å

PDB Description: MutM (Fpg)-DNA Estranged Guanine Mismatch Recognition Complex

SCOP Domain Sequences for d1l2da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2da2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplael

SCOP Domain Coordinates for d1l2da2:

Click to download the PDB-style file with coordinates for d1l2da2.
(The format of our PDB-style files is described here.)

Timeline for d1l2da2: