Lineage for d1l2da1 (1l2d A:135-220)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362029Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 362030Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 362048Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (2 proteins)
    contains 4 helices in the core
  6. 362049Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 362050Species Bacillus stearothermophilus [TaxId:1422] [81611] (7 PDB entries)
  8. 362054Domain d1l2da1: 1l2d A:135-220 [75920]
    Other proteins in same PDB: d1l2da2, d1l2da3
    DNA estranged guanine mismatch recognition complex
    complexed with hpd, zn

Details for d1l2da1

PDB Entry: 1l2d (more details), 2 Å

PDB Description: MutM (Fpg)-DNA Estranged Guanine Mismatch Recognition Complex

SCOP Domain Sequences for d1l2da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2da1 a.156.1.2 (A:135-220) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus}
gpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavmkggs

SCOP Domain Coordinates for d1l2da1:

Click to download the PDB-style file with coordinates for d1l2da1.
(The format of our PDB-style files is described here.)

Timeline for d1l2da1: