Lineage for d1l1ta3 (1l1t A:235-274)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523848Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 523849Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families) (S)
  5. 524023Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 524024Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 524025Species Bacillus stearothermophilus [TaxId:1422] [81613] (7 PDB entries)
  8. 524028Domain d1l1ta3: 1l1t A:235-274 [75910]
    Other proteins in same PDB: d1l1ta1, d1l1ta2
    bound to abasic-site containing DNA

Details for d1l1ta3

PDB Entry: 1l1t (more details), 1.8 Å

PDB Description: MutM (Fpg) Bound to Abasic-Site Containing DNA

SCOP Domain Sequences for d1l1ta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1ta3 g.39.1.8 (A:235-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus}
fqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr

SCOP Domain Coordinates for d1l1ta3:

Click to download the PDB-style file with coordinates for d1l1ta3.
(The format of our PDB-style files is described here.)

Timeline for d1l1ta3: