Lineage for d1l1ta2 (1l1t A:2-134)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1562900Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 1562901Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
    automatically mapped to Pfam PF01149
  5. 1562902Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 1562903Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 1562904Species Bacillus stearothermophilus [TaxId:1422] [81612] (23 PDB entries)
  8. 1562912Domain d1l1ta2: 1l1t A:2-134 [75909]
    Other proteins in same PDB: d1l1ta1, d1l1ta3
    bound to abasic-site containing DNA
    protein/DNA complex; complexed with zn

Details for d1l1ta2

PDB Entry: 1l1t (more details), 1.8 Å

PDB Description: MutM (Fpg) Bound to Abasic-Site Containing DNA
PDB Compounds: (A:) MutM

SCOPe Domain Sequences for d1l1ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1ta2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplael

SCOPe Domain Coordinates for d1l1ta2:

Click to download the PDB-style file with coordinates for d1l1ta2.
(The format of our PDB-style files is described here.)

Timeline for d1l1ta2: