![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
![]() | Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries) |
![]() | Domain d1l1ta1: 1l1t A:135-220 [75908] Other proteins in same PDB: d1l1ta2, d1l1ta3 bound to abasic-site containing DNA protein/DNA complex; complexed with zn |
PDB Entry: 1l1t (more details), 1.8 Å
SCOPe Domain Sequences for d1l1ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1ta1 a.156.1.2 (A:135-220) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} gpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdeslfragilpgrpaas lsskeierlheemvatigeavmkggs
Timeline for d1l1ta1: