Lineage for d1knya2 (1kny A:1-125)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051020Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1051021Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) (S)
  5. 1051022Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (1 protein)
    insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243
  6. 1051023Protein Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56709] (1 species)
  7. 1051024Species Staphylococcus aureus [TaxId:1280] [56710] (2 PDB entries)
  8. 1051025Domain d1knya2: 1kny A:1-125 [75897]
    Other proteins in same PDB: d1knya1, d1knyb1
    complexed with apc, kan, mg

Details for d1knya2

PDB Entry: 1kny (more details), 2.5 Å

PDB Description: kanamycin nucleotidyltransferase
PDB Compounds: (A:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d1knya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knya2 d.218.1.1 (A:1-125) Kanamycin nucleotidyltransferase (KNTase), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
eaefshewttgewkvevnfyseeilldyasqvesdwplthgqffsilpiydsggylekvy
qtaks

SCOPe Domain Coordinates for d1knya2:

Click to download the PDB-style file with coordinates for d1knya2.
(The format of our PDB-style files is described here.)

Timeline for d1knya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1knya1