![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) ![]() a distorted variant of double-helix |
![]() | Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein) |
![]() | Protein Calcium ATPase, transduction domain A [81651] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (14 PDB entries) Uniprot P04191 |
![]() | Domain d1kjua1: 1kju A:125-239 [75892] Other proteins in same PDB: d1kjua2, d1kjua3, d1kjua4 Structure in the e2 state |
PDB Entry: 1kju (more details), 6 Å
SCOPe Domain Sequences for d1kjua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjua1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d1kjua1: