Lineage for d1huoa4 (1huo A:149-334)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1229335Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1229336Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) (S)
  5. 1229344Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 1229345Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 1229454Species Norway rat (Rattus norvegicus) [TaxId:10116] [81576] (18 PDB entries)
  8. 1229464Domain d1huoa4: 1huo A:149-334 [75847]
    Other proteins in same PDB: d1huoa1, d1huoa3, d1huob1, d1huob3
    protein/DNA complex; complexed with cr, tte

Details for d1huoa4

PDB Entry: 1huo (more details), 2.6 Å

PDB Description: crystal structure of dna polymerase beta complexed with dna and cr-tmppcp
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1huoa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huoa4 d.218.1.2 (A:149-334) DNA polymerase beta, catalytic (31 kD) fragment {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryr
epkdrs

SCOPe Domain Coordinates for d1huoa4:

Click to download the PDB-style file with coordinates for d1huoa4.
(The format of our PDB-style files is described here.)

Timeline for d1huoa4: