Lineage for d1fa0a4 (1fa0 A:3-201)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563564Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2563565Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2563854Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543
  6. 2563855Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species)
  7. 2563856Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81586] (5 PDB entries)
  8. 2563861Domain d1fa0a4: 1fa0 A:3-201 [75838]
    Other proteins in same PDB: d1fa0a1, d1fa0a3, d1fa0b1, d1fa0b3, d1fa0b5
    complexed with 3ad, 3at, mn, pop

Details for d1fa0a4

PDB Entry: 1fa0 (more details), 2.6 Å

PDB Description: structure of yeast poly(a) polymerase bound to manganate and 3'-datp
PDB Compounds: (A:) poly(a)-polymerase

SCOPe Domain Sequences for d1fa0a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fa0a4 d.218.1.3 (A:3-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrf
vyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfds
llrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnlde
kdlralngtrvtdeilelv

SCOPe Domain Coordinates for d1fa0a4:

Click to download the PDB-style file with coordinates for d1fa0a4.
(The format of our PDB-style files is described here.)

Timeline for d1fa0a4: