Lineage for d1m7ka_ (1m7k A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763928Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764112Superfamily a.7.7: BAG domain [63491] (1 family) (S)
  5. 764113Family a.7.7.1: BAG domain [63492] (4 proteins)
    Pfam PF02179
    this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain
  6. 764128Protein Silencer of death domains, Sodd (Bag4) [74699] (1 species)
  7. 764129Species Human (Homo sapiens) [TaxId:9606] [74700] (2 PDB entries)
  8. 764130Domain d1m7ka_: 1m7k A: [74573]

Details for d1m7ka_

PDB Entry: 1m7k (more details)

PDB Description: solution structure of the sodd bag domain
PDB Compounds: (A:) Silencer of Death Domains

SCOP Domain Sequences for d1m7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ka_ a.7.7.1 (A:) Silencer of death domains, Sodd (Bag4) {Human (Homo sapiens) [TaxId: 9606]}
tppsikkiihvlekvqyleqeveefvgkktdkaywlleemltkelleldsvetggqdsvr
qarkeavckiqaileklekkg

SCOP Domain Coordinates for d1m7ka_:

Click to download the PDB-style file with coordinates for d1m7ka_.
(The format of our PDB-style files is described here.)

Timeline for d1m7ka_: