Lineage for d1m6vb1 (1m6v B:2-152)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979734Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 979813Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 979814Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 979815Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 979816Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
    Uniprot P00907
  8. 979845Domain d1m6vb1: 1m6v B:2-152 [74542]
    Other proteins in same PDB: d1m6va1, d1m6va2, d1m6va3, d1m6va4, d1m6va5, d1m6va6, d1m6vb2, d1m6vc1, d1m6vc2, d1m6vc3, d1m6vc4, d1m6vc5, d1m6vc6, d1m6vd2, d1m6ve1, d1m6ve2, d1m6ve3, d1m6ve4, d1m6ve5, d1m6ve6, d1m6vf2, d1m6vg1, d1m6vg2, d1m6vg3, d1m6vg4, d1m6vg5, d1m6vg6, d1m6vh2
    complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1m6vb1

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase
PDB Compounds: (B:) Carbamoyl-phosphate synthetase small chain

SCOPe Domain Sequences for d1m6vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6vb1 c.8.3.1 (B:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOPe Domain Coordinates for d1m6vb1:

Click to download the PDB-style file with coordinates for d1m6vb1.
(The format of our PDB-style files is described here.)

Timeline for d1m6vb1: