SCOPe 2.08: Domain d1m6va1: 1m6v A:403-555

Lineage for d1m6va1 (1m6v A:403-555)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   possible duplication: subdomains have similar topologies

4. Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family)
   automatically mapped to Pfam PF02787

5. Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)

6. Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)

7. Species Escherichia coli [TaxId:562] [48111] (10 PDB entries)
   Uniprot P00968

8. Domain d1m6va1: 1m6v A:403-555 [74536]
   Other proteins in same PDB: d1m6va2, d1m6va3, d1m6va4, d1m6va5, d1m6va6, d1m6vb1, d1m6vb2, d1m6vc2, d1m6vc3, d1m6vc4, d1m6vc5, d1m6vc6, d1m6vd1, d1m6vd2, d1m6ve2, d1m6ve3, d1m6ve4, d1m6ve5, d1m6ve6, d1m6vf1, d1m6vf2, d1m6vg2, d1m6vg3, d1m6vg4, d1m6vg5, d1m6vg6, d1m6vh1, d1m6vh2
   complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1m6va1

PDB Entry: 1m6v, 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase

PDB Compounds: (A:) carbamoyl phosphate synthetase large chain

SCOPe Domain Sequences for d1m6va1:

Sequence; same for both SEQRES and ATOM records:

>d1m6va1 a.92.1.1 (A:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli [TaxId: 562]}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

Timeline for d1m6va1:

• d1m6va1 first appeared in SCOP 1.61
  
• d1m6va1 appears in SCOPe 2.07