SCOPe 2.07: Domain d1m62a1: 1m62 A:376-457

Lineage for d1m62a1 (1m62 A:376-457)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.7: BAG domain [63491] (1 family)

5. Family a.7.7.1: BAG domain [63492] (4 proteins)
   Pfam PF02179
   this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain

6. Protein Silencer of death domains, Sodd (Bag4) [74699] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74700] (2 PDB entries)

8. Domain d1m62a1: 1m62 A:376-457 [74520]
   Other proteins in same PDB: d1m62a2

Details for d1m62a1

PDB Entry: 1m62

PDB Description: solution structure of the bag domain from bag4/sodd

PDB Compounds: (A:) BAG-family molecular chaperone regulator-4

SCOPe Domain Sequences for d1m62a1:

Sequence; same for both SEQRES and ATOM records:

>d1m62a1 a.7.7.1 (A:376-457) Silencer of death domains, Sodd (Bag4) {Human (Homo sapiens) [TaxId: 9606]}
tppsikkiihvlekvqyleqeveefvgkktdkaywlleemltkelleldsvetggqdsvr
qarkeavckiqaileklekkgl

Timeline for d1m62a1:

• d1m62a1 first appeared in SCOP 1.61, called d1m62a_
  
• d1m62a1 appears in SCOPe 2.06
  
• d1m62a1 appears in the current release, SCOPe 2.08