SCOPe 2.04: Domain d1m55a_: 1m55 A:

Lineage for d1m55a_ (1m55 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families)

5. Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (1 protein)
   automatically mapped to Pfam PF08724

6. Protein Replication protein Rep, nuclease domain [75493] (1 species)

7. Species Adeno-associated virus, aav-5 [TaxId:272636] [75494] (3 PDB entries)

8. Domain d1m55a_: 1m55 A: [74469]
   complexed with cl, zn

Details for d1m55a_

PDB Entry: 1m55, 1.4 Å

PDB Description: Catalytic domain of the Adeno Associated Virus type 5 Rep protein

PDB Compounds: (A:) Rep protein

SCOPe Domain Sequences for d1m55a_:

Sequence; same for both SEQRES and ATOM records:

>d1m55a_ d.89.1.3 (A:) Replication protein Rep, nuclease domain {Adeno-associated virus, aav-5 [TaxId: 272636]}
matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir
rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf
qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle
erkrlvaqflaes

Timeline for d1m55a_:

• d1m55a_ first appeared in SCOP 1.61
  
• d1m55a_ appears in SCOPe 2.03
  
• d1m55a_ appears in SCOPe 2.05
  
• d1m55a_ appears in the current release, SCOPe 2.08