Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (1 family) |
Family b.1.15.1: Integrin domains [69180] (2 proteins) |
Protein Hybrid domain of integrin beta [69183] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69184] (5 PDB entries) Uniprot P05106 27-466 |
Domain d1m1xb1: 1m1x B:55-106,B:355-434 [74426] Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb2, d1m1xb3, d1m1xb4, d1m1xb5 complexed with mn, nag |
PDB Entry: 1m1x (more details), 3.3 Å
SCOPe Domain Sequences for d1m1xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1xb1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]} efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf kdslivqvtfdcd
Timeline for d1m1xb1:
View in 3D Domains from same chain: (mouse over for more information) d1m1xb2, d1m1xb3, d1m1xb4, d1m1xb5 |
View in 3D Domains from other chains: (mouse over for more information) d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4 |