SCOP 1.61: Domain d1m1pb_: 1m1p B:

Lineage for d1m1pb_ (1m1p B:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)

5. Family a.138.1.3: Di-heme elbow motif [48711] (6 proteins)

6. Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)

7. Species Shewanella oneidensis [TaxId:70863] [74808] (3 PDB entries)

8. Domain d1m1pb_: 1m1p B: [74414]

Details for d1m1pb_

PDB Entry: 1m1p, 1.55 Å

PDB Description: p21 crystal structure of the tetraheme cytochrome c3 from shewanella oneidensis mr1

SCOP Domain Sequences for d1m1pb_:

Sequence, based on SEQRES records:

>d1m1pb_ a.138.1.3 (B:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis}
dqklsdfhaesggceschkdgtpsadgafefaqcqschgklsemdavhkphdgnlvcadc
havhdmnvgqkptceschddgrtsasvlkk

Sequence, based on observed residues (ATOM records):

>d1m1pb_ a.138.1.3 (B:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis}
dqklsdfhaeggceschkdgtpsadgafefaqcqschgklsemdavhkphdgnlvcadch
avhdmnvgqkptceschddgrtsasvlkk

Timeline for d1m1pb_:

• d1m1pb_ is new in SCOP 1.61
  
• d1m1pb_ appears in SCOP 1.63
  
• d1m1pb_ appears in the current release, SCOPe 2.08