SCOPe 2.08: Domain d1m1jf2: 1m1j F:5-141

Lineage for d1m1jf2 (1m1j F:5-141)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [88899] (1 PDB entry)

8. Domain d1m1jf2: 1m1j F:5-141 [74378]
   Other proteins in same PDB: d1m1ja_, d1m1jb1, d1m1jb2, d1m1jc1, d1m1jd_, d1m1je1, d1m1je2, d1m1jf1
   complexed with ca, nag, ndg

Details for d1m1jf2

PDB Entry: 1m1j, 2.7 Å

PDB Description: crystal structure of native chicken fibrinogen with two different bound ligands

PDB Compounds: (F:) Fibrinogen gamma chain

SCOPe Domain Sequences for d1m1jf2:

Sequence; same for both SEQRES and ATOM records:

>d1m1jf2 h.1.8.1 (F:5-141) Fibrinogen gamma chain {Chicken (Gallus gallus) [TaxId: 9031]}
renccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyliqhi
ktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnkitql
kqkiaqleshcqepckd

Timeline for d1m1jf2:

• d1m1jf2 first appeared in SCOP 1.61
  
• d1m1jf2 appears in SCOPe 2.07