![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
![]() | Protein Fibrinogen alpha chain [88887] (4 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [88888] (1 PDB entry) |
![]() | Domain d1m1jd_: 1m1j D: [74374] Other proteins in same PDB: d1m1jb1, d1m1jb2, d1m1jc1, d1m1jc2, d1m1je1, d1m1je2, d1m1jf1, d1m1jf2 complexed with ca, nag |
PDB Entry: 1m1j (more details), 2.7 Å
SCOP Domain Sequences for d1m1jd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1jd_ h.1.8.1 (D:) Fibrinogen alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} sckyeknwpicvdddwgtkcpsgcrmqgiiddtdqnysqridnirqqladsqnkyktsnr vivetinilkpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvv emkrlevdidikirackgscarsfdyqvdkegydniqkhltqassidmhpdfqtttlstl kmrplkdsnvpehf
Timeline for d1m1jd_: