Lineage for d1m1jd_ (1m1j D:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895301Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 895302Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 895303Protein Fibrinogen alpha chain [88887] (4 species)
  7. 895304Species Chicken (Gallus gallus) [TaxId:9031] [88888] (1 PDB entry)
  8. 895306Domain d1m1jd_: 1m1j D: [74374]
    Other proteins in same PDB: d1m1jb1, d1m1jb2, d1m1jc1, d1m1jc2, d1m1je1, d1m1je2, d1m1jf1, d1m1jf2
    complexed with ca, nag

Details for d1m1jd_

PDB Entry: 1m1j (more details), 2.7 Å

PDB Description: crystal structure of native chicken fibrinogen with two different bound ligands
PDB Compounds: (D:) Fibrinogen alpha subunit

SCOP Domain Sequences for d1m1jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1jd_ h.1.8.1 (D:) Fibrinogen alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
sckyeknwpicvdddwgtkcpsgcrmqgiiddtdqnysqridnirqqladsqnkyktsnr
vivetinilkpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvv
emkrlevdidikirackgscarsfdyqvdkegydniqkhltqassidmhpdfqtttlstl
kmrplkdsnvpehf

SCOP Domain Coordinates for d1m1jd_:

Click to download the PDB-style file with coordinates for d1m1jd_.
(The format of our PDB-style files is described here.)

Timeline for d1m1jd_: