Lineage for d1m1jd1 (1m1j D:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205391Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
  4. 205752Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 205753Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 205754Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
  7. 205755Species Chicken (Gallus gallus) [TaxId:9031] [69976] (1 PDB entry)
  8. 205759Domain d1m1jd1: 1m1j D: [74374]
    Other proteins in same PDB: d1m1jb1, d1m1jc1, d1m1je1, d1m1jf1

Details for d1m1jd1

PDB Entry: 1m1j (more details), 2.7 Å

PDB Description: crystal structure of native chicken fibrinogen with two different bound ligands

SCOP Domain Sequences for d1m1jd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1jd1 h.1.8.1 (D:) Fibrinogen coiled-coil and central regions {Chicken (Gallus gallus)}
sckyeknwpicvdddwgtkcpsgcrmqgiiddtdqnysqridnirqqladsqnkyktsnr
vivetinilkpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvv
emkrlevdidikirackgscarsfdyqvdkegydniqkhltqassidmhpdfqtttlstl
kmrplkdsnvpehf

SCOP Domain Coordinates for d1m1jd1:

Click to download the PDB-style file with coordinates for d1m1jd1.
(The format of our PDB-style files is described here.)

Timeline for d1m1jd1: