Lineage for d1m11r_ (1m11 R:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1711988Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 1711989Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 1711990Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 1712007Protein Decay-accelerating factor bound to echovirus 7 [75716] (1 species)
  7. 1712008Species Human (Homo sapiens) and human echovirus 7 [TaxId:9606] [75717] (1 PDB entry)
  8. 1712012Domain d1m11r_: 1m11 R: [74366]

Details for d1m11r_

PDB Entry: 1m11 (more details), 16 Å

PDB Description: structural model of human decay-accelerating factor bound to echovirus 7 from cryo-electron microscopy
PDB Compounds: (R:) decay-accelerating factor

SCOPe Domain Sequences for d1m11r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m11r_ i.6.1.1 (R:) Decay-accelerating factor bound to echovirus 7 {Human (Homo sapiens) and human echovirus 7 [TaxId: 9606]}
dcglppdvpnaqpalegrtsfpedtvitykceesfvkipgekdsviclkgsqwsdieefc
nrscevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwsta
vefckkkscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqws
dplpecreiycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndeg
ews

SCOPe Domain Coordinates for d1m11r_:

Click to download the PDB-style file with coordinates for d1m11r_.
(The format of our PDB-style files is described here.)

Timeline for d1m11r_: