SCOPe 2.02: Domain d1m113_: 1m11 3:

Lineage for d1m113_ (1m11 3:)

1. Root: SCOPe 2.02

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)

6. Protein Decay-accelerating factor bound to echovirus 7 [75716] (1 species)

7. Species Human (Homo sapiens) and human echovirus 7 [TaxId:9606] [75717] (1 PDB entry)

8. Domain d1m113_: 1m11 3: [74365]

Details for d1m113_

PDB Entry: 1m11, 16 Å

PDB Description: structural model of human decay-accelerating factor bound to echovirus 7 from cryo-electron microscopy

PDB Compounds: (3:) coat protein vp3

SCOPe Domain Sequences for d1m113_:

Sequence; same for both SEQRES and ATOM records:

>d1m113_ i.6.1.1 (3:) Decay-accelerating factor bound to echovirus 7 {Human (Homo sapiens) and human echovirus 7 [TaxId: 9606]}
gfpvlntpgsnqfmtsddfqspsampqfdvtphmdipgevhnlmeiaevdsvvpvnnikv
nlqsmdayhievntgnhqgekifafqmqpglesvfkrtlmgeilnyyahwsgsikltftf
cgsamatgklllaysppgadvpatrkqamlgthmiwdiglqsscvlcipwisqthyrlvq
qdeytsagnvtcwyqtgivvppgtpnkcvvlcfasacndfsvrmlrdtpfigqtallq

Timeline for d1m113_:

• d1m113_ first appeared in SCOP 1.61
  
• d1m113_ appears in SCOPe 2.01
  
• d1m113_ appears in SCOPe 2.03
  
• d1m113_ appears in the current release, SCOPe 2.08