Lineage for d1m112_ (1m11 2:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044501Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 3044502Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 3044503Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 3044520Protein Decay-accelerating factor bound to echovirus 7 [75716] (1 species)
  7. 3044521Species Human (Homo sapiens) and human echovirus 7 [TaxId:9606] [75717] (1 PDB entry)
  8. 3044523Domain d1m112_: 1m11 2: [74364]

Details for d1m112_

PDB Entry: 1m11 (more details)

PDB Description: structural model of human decay-accelerating factor bound to echovirus 7 from cryo-electron microscopy
PDB Compounds: (2:) coat protein vp2

SCOPe Domain Sequences for d1m112_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m112_ i.6.1.1 (2:) Decay-accelerating factor bound to echovirus 7 {Human (Homo sapiens) and human echovirus 7 [TaxId: 9606]}
gysdrvrsltlgnstittqesanvvvgygrwpeylrddeataedqptqpdvatcrfytle
svqweknsagwwwkfpealkdmglfgqnmlyhylgragytihvqcnaskfhqgcllvvcv
peaemgcsqtdkevaamnltkgeaahkfeptkttgehtvqsivcnagmgvgvgnltiyph
qwinlrtnncativmpyvnsvpmdnmfrhynftlmvipfapldyaaqaseyvpvtvtiap
mcaeynglrlayqq

SCOPe Domain Coordinates for d1m112_:

Click to download the PDB-style file with coordinates for d1m112_.
(The format of our PDB-style files is described here.)

Timeline for d1m112_: