Lineage for d1m111_ (1m11 1:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 273319Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 273320Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 273321Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)
  6. 273338Protein Decay-accelerating factor bound to echovirus 7 [75716] (1 species)
  7. 273339Species Human (Homo sapiens) and human echovirus 7 [TaxId:9606] [75717] (1 PDB entry)
  8. 273340Domain d1m111_: 1m11 1: [74363]

Details for d1m111_

PDB Entry: 1m11 (more details)

PDB Description: structural model of human decay-accelerating factor bound to echovirus 7 from cryo-electron microscopy

SCOP Domain Sequences for d1m111_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m111_ i.6.1.1 (1:) Decay-accelerating factor bound to echovirus 7 {Human (Homo sapiens) and human echovirus 7}
gdtetaidnaiarvadtvasgpsnstsipaltavetghtsqvepsdtmqtrhvknyhsrs
estvenflsrsacvyieeyytkdqdnvnrymswtinarrmvqlrrkfelftymrfdmeit
fvitsrqlpgtsiaqdmpplthqimyippggpvpnsvtdfawqtstnpsifwtegnappr
msipfisignaysnfydgwshfsqngvygynalnnmgklyarhvnkdtpyqmsstirvyf
kpkhirvwvprpprlspyikssnvnfnptnltderssi

SCOP Domain Coordinates for d1m111_:

Click to download the PDB-style file with coordinates for d1m111_.
(The format of our PDB-style files is described here.)

Timeline for d1m111_: