![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) ![]() |
![]() | Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein) |
![]() | Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species) forms dimer by swapping the common core elements |
![]() | Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries) |
![]() | Domain d1m0dd_: 1m0d D: [74357] complexed with mn, so4 |
PDB Entry: 1m0d (more details), 1.9 Å
SCOPe Domain Sequences for d1m0dd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m0dd_ c.52.1.17 (D:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7 [TaxId: 10760]} sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvetkglwesddrk khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke vpfdrlkrk
Timeline for d1m0dd_: