Lineage for d1m0db_ (1m0d B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994432Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 994433Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 994628Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein)
  6. 994629Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)
    forms dimer by swapping the common core elements
  7. 994630Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries)
  8. 994632Domain d1m0db_: 1m0d B: [74355]
    complexed with mn, so4

Details for d1m0db_

PDB Entry: 1m0d (more details), 1.9 Å

PDB Description: Crystal Structure of Bacteriophage T7 Endonuclease I with a Wild-Type Active Site and Bound Manganese Ions
PDB Compounds: (B:) Endodeoxyribonuclease I

SCOPe Domain Sequences for d1m0db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0db_ c.52.1.17 (B:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7 [TaxId: 10760]}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvetkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

SCOPe Domain Coordinates for d1m0db_:

Click to download the PDB-style file with coordinates for d1m0db_.
(The format of our PDB-style files is described here.)

Timeline for d1m0db_: