Lineage for d1lwug_ (1lwu G:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895301Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 895302Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 895303Protein Fibrinogen alpha chain [88887] (4 species)
  7. 895360Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [88891] (2 PDB entries)
  8. 895363Domain d1lwug_: 1lwu G: [74319]
    Other proteins in same PDB: d1lwub1, d1lwub2, d1lwuc1, d1lwuc2, d1lwue1, d1lwue2, d1lwuf1, d1lwuf2, d1lwuh1, d1lwuh2, d1lwui1, d1lwui2, d1lwuk1, d1lwuk2, d1lwul1, d1lwul2
    coiled-coil region only

Details for d1lwug_

PDB Entry: 1lwu (more details), 2.8 Å

PDB Description: crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide
PDB Compounds: (G:) Fibrinogen alpha-1 chain

SCOP Domain Sequences for d1lwug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwug_ h.1.8.1 (G:) Fibrinogen alpha chain {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
nelevrysevlrelerriihlqrrinmqlqqltllqhniktqvsqilrvevdidvalrac
kgscaryleyrldkeknlqlekaasyianlkferfeevv

SCOP Domain Coordinates for d1lwug_:

Click to download the PDB-style file with coordinates for d1lwug_.
(The format of our PDB-style files is described here.)

Timeline for d1lwug_: