SCOP 1.75: Domain d1lwua_: 1lwu A:

Lineage for d1lwua_ (1lwu A:)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen alpha chain [88887] (4 species)

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [88891] (2 PDB entries)

8. Domain d1lwua_: 1lwu A: [74309]
   Other proteins in same PDB: d1lwub1, d1lwub2, d1lwuc1, d1lwuc2, d1lwue1, d1lwue2, d1lwuf1, d1lwuf2, d1lwuh1, d1lwuh2, d1lwui1, d1lwui2, d1lwuk1, d1lwuk2, d1lwul1, d1lwul2
   coiled-coil region only

Details for d1lwua_

PDB Entry: 1lwu, 2.8 Å

PDB Description: crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide

PDB Compounds: (A:) Fibrinogen alpha-1 chain

SCOP Domain Sequences for d1lwua_:

Sequence; same for both SEQRES and ATOM records:

>d1lwua_ h.1.8.1 (A:) Fibrinogen alpha chain {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
nelevrysevlrelerriihlqrrinmqlqqltllqhniktqvsqilrvevdidvalrac
kgscaryleyrldkeknlqlekaasyianlkferfeevv

Timeline for d1lwua_:

• d1lwua_ first appeared in SCOP 1.61, called d1lwua1
  
• d1lwua_ appears in SCOP 1.73
  
• d1lwua_ appears in SCOPe 2.01
  
• d1lwua_ appears in the current release, SCOPe 2.08