Class a: All alpha proteins [46456] (290 folds) |
Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
Superfamily a.152.1: AhpD-like [69118] (4 families) probable biological unit contains six domains of this fold arranged with 32 symmetry |
Family a.152.1.1: AhpD [69119] (2 proteins) duplication: two-domain subunits form a helix-swapped trimer |
Protein Antioxidant defense protein AhpD [69120] (1 species) a novel enzyme with thioredoxin-like activity |
Species Mycobacterium tuberculosis [TaxId:1773] [69121] (4 PDB entries) |
Domain d1lw1c_: 1lw1 C: [74292] mutant |
PDB Entry: 1lw1 (more details), 2.3 Å
SCOPe Domain Sequences for d1lw1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lw1c_ a.152.1.1 (C:) Antioxidant defense protein AhpD {Mycobacterium tuberculosis [TaxId: 1773]} ieklkaalpeyakdiklnlssitrssvldqeqlwgtllasaaatrnpqvladigaeatdh lsaaarhaalgaaaimgmnnvfyrgrgflegryddlrpglrmniianpgipkanfelwsf avsaingcshclvafehtlrtvgvdreaifealkaaaivsgvaqalatieal
Timeline for d1lw1c_: