Class a: All alpha proteins [46456] (226 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) contains a small beta-sheet (wing) |
Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (1 protein) |
Protein C-terminal fragment of elongation factor SelB [74684] (1 species) duplication: tandem repeat of four "winged helix" domains |
Species Moorella thermoacetica [TaxId:1525] [74685] (1 PDB entry) |
Domain d1lvaa3: 1lva A:511-574 [74278] |
PDB Entry: 1lva (more details), 2.12 Å
SCOP Domain Sequences for d1lvaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica} fsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindef ywhr
Timeline for d1lvaa3: