Lineage for d1lvaa3 (1lva A:511-574)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150081Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) (S)
  5. 150466Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (1 protein)
  6. 150467Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
  7. 150468Species Moorella thermoacetica [TaxId:1525] [74685] (1 PDB entry)
  8. 150471Domain d1lvaa3: 1lva A:511-574 [74278]

Details for d1lvaa3

PDB Entry: 1lva (more details), 2.12 Å

PDB Description: Crystal structure of a C-terminal fragment of Moorella thermoacetica elongation factor SelB

SCOP Domain Sequences for d1lvaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica}
fsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindef
ywhr

SCOP Domain Coordinates for d1lvaa3:

Click to download the PDB-style file with coordinates for d1lvaa3.
(The format of our PDB-style files is described here.)

Timeline for d1lvaa3: