Lineage for d1luvb1 (1luv B:1-83)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209616Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 209725Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 209726Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 209802Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 209846Species Human (Homo sapiens) [TaxId:9606] [46619] (11 PDB entries)
  8. 209852Domain d1luvb1: 1luv B:1-83 [74265]
    Other proteins in same PDB: d1luva2, d1luvb2
    complexed with mn; mutant

Details for d1luvb1

PDB Entry: 1luv (more details), 1.85 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel

SCOP Domain Sequences for d1luvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luvb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1luvb1:

Click to download the PDB-style file with coordinates for d1luvb1.
(The format of our PDB-style files is described here.)

Timeline for d1luvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1luvb2