SCOP 1.67: Domain d1luva2: 1luv A:84-198

Lineage for d1luva2 (1luv A:84-198)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (14 PDB entries)

8. Domain d1luva2: 1luv A:84-198 [74264]
   Other proteins in same PDB: d1luva1, d1luvb1

Details for d1luva2

PDB Entry: 1luv, 1.85 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel

SCOP Domain Sequences for d1luva2:

Sequence; same for both SEQRES and ATOM records:

>d1luva2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1luva2:

• d1luva2 first appeared in SCOP 1.61
  
• d1luva2 appears in SCOP 1.65
  
• d1luva2 appears in SCOP 1.69
  
• d1luva2 appears in the current release, SCOPe 2.08