Lineage for d1luva2 (1luv A:84-198)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191397Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 191398Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 191399Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 191475Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)
  7. 191515Species Human (Homo sapiens) [TaxId:9606] [54724] (11 PDB entries)
  8. 191518Domain d1luva2: 1luv A:84-198 [74264]
    Other proteins in same PDB: d1luva1, d1luvb1

Details for d1luva2

PDB Entry: 1luv (more details), 1.85 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel

SCOP Domain Sequences for d1luva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luva2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1luva2:

Click to download the PDB-style file with coordinates for d1luva2.
(The format of our PDB-style files is described here.)

Timeline for d1luva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1luva1