SCOP 1.61: Domain d1lusa1: 1lus A:1-83

Lineage for d1lusa1 (1lus A:1-83)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (11 PDB entries)

8. Domain d1lusa1: 1lus A:1-83 [74259]
   Other proteins in same PDB: d1lusa2, d1lusb2

Details for d1lusa1

PDB Entry: 1lus, 2.11 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human mnsod: insertion of val cgamma into the substrate access channel

SCOP Domain Sequences for d1lusa1:

Sequence; same for both SEQRES and ATOM records:

>d1lusa1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskvhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d1lusa1:

• d1lusa1 is new in SCOP 1.61
  
• d1lusa1 does not appear in SCOP 1.63