| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.6: omega toxin-like [57059] (5 families) ![]() |
| Family g.3.6.2: Spider toxins [57072] (25 proteins) |
| Protein GSmtx2 [75662] (1 species) |
| Species Chilean rose tarantula (Grammostola spatulata) [TaxId:432528] [75663] (1 PDB entry) |
| Domain d1lupa_: 1lup A: [74258] |
PDB Entry: 1lup (more details)
SCOPe Domain Sequences for d1lupa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lupa_ g.3.6.2 (A:) GSmtx2 {Chilean rose tarantula (Grammostola spatulata) [TaxId: 432528]}
ycqkwmwtcdeerkcceglvcrlwckriinm
Timeline for d1lupa_: