Lineage for d1lupa_ (1lup A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1061763Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 1061804Family g.3.6.2: Spider toxins [57072] (25 proteins)
  6. 1061821Protein GSmtx2 [75662] (1 species)
  7. 1061822Species Chilean rose tarantula (Grammostola spatulata) [TaxId:432528] [75663] (1 PDB entry)
  8. 1061823Domain d1lupa_: 1lup A: [74258]

Details for d1lupa_

PDB Entry: 1lup (more details)

PDB Description: solution structure of a toxin (gsmtx2) from the tarantula, grammostola spatulata, which inhibits mechanosensitive ion channels
PDB Compounds: (A:) GsMTx2

SCOPe Domain Sequences for d1lupa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lupa_ g.3.6.2 (A:) GSmtx2 {Chilean rose tarantula (Grammostola spatulata) [TaxId: 432528]}
ycqkwmwtcdeerkcceglvcrlwckriinm

SCOPe Domain Coordinates for d1lupa_:

Click to download the PDB-style file with coordinates for d1lupa_.
(The format of our PDB-style files is described here.)

Timeline for d1lupa_: