Lineage for d1lrja_ (1lrj A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1347754Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (4 species)
  7. 1347757Species Escherichia coli [TaxId:562] [51753] (17 PDB entries)
  8. 1347771Domain d1lrja_: 1lrj A: [74224]
    complexed with na, nad, pge, ud1

Details for d1lrja_

PDB Entry: 1lrj (more details), 1.9 Å

PDB Description: crystal structure of e. coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine
PDB Compounds: (A:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d1lrja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrja_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]}
mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
fsssatvygdnpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
dghvvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd

SCOPe Domain Coordinates for d1lrja_:

Click to download the PDB-style file with coordinates for d1lrja_.
(The format of our PDB-style files is described here.)

Timeline for d1lrja_: