Lineage for d1lova_ (1lov A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2531209Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)
  6. 2531220Protein RNase T1 [53939] (2 species)
  7. 2531223Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)
  8. 2531225Domain d1lova_: 1lov A: [74166]
    complexed with 3gp, ca; mutant

Details for d1lova_

PDB Entry: 1lov (more details), 1.55 Å

PDB Description: x-ray structure of the e58a mutant of ribonuclease t1 complexed with 3'-guanosine monophosphate
PDB Compounds: (A:) guanyl-specific ribonuclease t1

SCOPe Domain Sequences for d1lova_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lova_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyawp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

SCOPe Domain Coordinates for d1lova_:

Click to download the PDB-style file with coordinates for d1lova_.
(The format of our PDB-style files is described here.)

Timeline for d1lova_: