Lineage for d1lotb2 (1lot B:147-373)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182000Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 182001Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)
  6. 182002Protein Actin [53073] (5 species)
  7. 182016Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (9 PDB entries)
  8. 182024Domain d1lotb2: 1lot B:147-373 [74165]
    Other proteins in same PDB: d1lota1, d1lota2, d1lota3

Details for d1lotb2

PDB Entry: 1lot (more details), 2.5 Å

PDB Description: crystal structure of the complex of actin with vitamin d-binding protein

SCOP Domain Sequences for d1lotb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lotb2 c.55.1.1 (B:147-373) Actin {Rabbit (Oryctolagus cuniculus)}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrk

SCOP Domain Coordinates for d1lotb2:

Click to download the PDB-style file with coordinates for d1lotb2.
(The format of our PDB-style files is described here.)

Timeline for d1lotb2: