SCOP 1.61: Domain d1lotb2: 1lot B:147-373

Lineage for d1lotb2 (1lot B:147-373)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families)

5. Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)

6. Protein Actin [53073] (5 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (9 PDB entries)

8. Domain d1lotb2: 1lot B:147-373 [74165]
   Other proteins in same PDB: d1lota1, d1lota2, d1lota3

Details for d1lotb2

PDB Entry: 1lot, 2.5 Å

PDB Description: crystal structure of the complex of actin with vitamin d-binding protein

SCOP Domain Sequences for d1lotb2:

Sequence; same for both SEQRES and ATOM records:

>d1lotb2 c.55.1.1 (B:147-373) Actin {Rabbit (Oryctolagus cuniculus)}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrk

Timeline for d1lotb2:

• d1lotb2 is new in SCOP 1.61
  
• d1lotb2 appears in SCOP 1.63
  
• d1lotb2 appears in the current release, SCOPe 2.08