Lineage for d1lota2 (1lot A:199-386)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1748371Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1748372Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 1748373Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1748677Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 1748678Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 1748704Domain d1lota2: 1lot A:199-386 [74162]
    Other proteins in same PDB: d1lotb1, d1lotb2
    complexed with atp, ca, gol

Details for d1lota2

PDB Entry: 1lot (more details), 2.5 Å

PDB Description: crystal structure of the complex of actin with vitamin d-binding protein
PDB Compounds: (A:) Vitamin D-binding protein

SCOPe Domain Sequences for d1lota2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lota2 a.126.1.1 (A:199-386) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv
cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk
elssfidk

SCOPe Domain Coordinates for d1lota2:

Click to download the PDB-style file with coordinates for d1lota2.
(The format of our PDB-style files is described here.)

Timeline for d1lota2: