SCOPe 2.07: Domain d1lo2y1: 1lo2 Y:1-119

Lineage for d1lo2y1 (1lo2 Y:1-119)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (15 PDB entries)
   Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity

8. Domain d1lo2y1: 1lo2 Y:1-119 [74129]
   Other proteins in same PDB: d1lo2h2, d1lo2l1, d1lo2l2, d1lo2x1, d1lo2x2, d1lo2y2
   part of retro Diels-Alder catalytic Fab 9D9
   complexed with ox1

Details for d1lo2y1

PDB Entry: 1lo2, 2 Å

PDB Description: retro-diels-alderase catalytic antibody

PDB Compounds: (Y:) Ig gamma 2a heavy chain

SCOPe Domain Sequences for d1lo2y1:

Sequence; same for both SEQRES and ATOM records:

>d1lo2y1 b.1.1.1 (Y:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsa

Timeline for d1lo2y1:

• d1lo2y1 first appeared in SCOP 1.61
  
• d1lo2y1 appears in SCOPe 2.06
  
• d1lo2y1 appears in the current release, SCOPe 2.08