Lineage for d1lo2l1 (1lo2 L:1-112)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158571Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74810] (4 PDB entries)
  8. 158577Domain d1lo2l1: 1lo2 L:1-112 [74125]
    Other proteins in same PDB: d1lo2h2, d1lo2l2, d1lo2x2, d1lo2y2

Details for d1lo2l1

PDB Entry: 1lo2 (more details), 2 Å

PDB Description: retro-diels-alderase catalytic antibody

SCOP Domain Sequences for d1lo2l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo2l1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain}
dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelk

SCOP Domain Coordinates for d1lo2l1:

Click to download the PDB-style file with coordinates for d1lo2l1.
(The format of our PDB-style files is described here.)

Timeline for d1lo2l1: