Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74810] (4 PDB entries) |
Domain d1lo2l1: 1lo2 L:1-112 [74125] Other proteins in same PDB: d1lo2h2, d1lo2l2, d1lo2x2, d1lo2y2 |
PDB Entry: 1lo2 (more details), 2 Å
SCOP Domain Sequences for d1lo2l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lo2l1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain} dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelk
Timeline for d1lo2l1: