SCOPe 2.01: Domain d1ln6a_: 1ln6 A:

Lineage for d1ln6a_ (1ln6 A:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.2: Rhodopsin-like [81320] (2 proteins)
   Individual TM segments have a number of kinks and distortions

6. Protein Rhodopsin [56876] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56877] (8 PDB entries)
   Uniprot P02699

8. Domain d1ln6a_: 1ln6 A: [74044]
   complexed with ret

Details for d1ln6a_

PDB Entry: 1ln6

PDB Description: structure of bovine rhodopsin (metarhodopsin ii)

PDB Compounds: (A:) rhodopsin

SCOPe Domain Sequences for d1ln6a_:

Sequence; same for both SEQRES and ATOM records:

>d1ln6a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]}
laaymfllimlgfpinfltlyvtvqhkklrtplnyillnlavadlfmvfggftttlytsl
hgyfvfgptgcnlegffatlggeialwslvvlaieryvvvckpmsnfrfgenhaimgvaf
twvmalacaapplvgwsryipegmqcscgidyytpheetnnesfviymfvvhfiiplivi
ffcygqlvftvkeaaaqqqesattqkaekevtrmviimviaflicwlpyagvafyifthq
gsdfgpifmtipaffaktsavynpviyimmnkqfrncmvttlccgknplgddeasttvsk
tetsqvapa

Timeline for d1ln6a_:

• d1ln6a_ first appeared in SCOP 1.61
  
• d1ln6a_ appears in SCOP 1.75
  
• d1ln6a_ appears in SCOPe 2.02
  
• d1ln6a_ appears in the current release, SCOPe 2.08