Lineage for d1ln6a_ (1ln6 A:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058733Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 1058734Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families) (S)
  5. 1058870Family f.13.1.2: Rhodopsin-like [81320] (2 proteins)
    Individual TM segments have a number of kinks and distortions
  6. 1058871Protein Rhodopsin [56876] (1 species)
  7. 1058872Species Cow (Bos taurus) [TaxId:9913] [56877] (8 PDB entries)
    Uniprot P02699
  8. 1058884Domain d1ln6a_: 1ln6 A: [74044]
    complexed with ret

Details for d1ln6a_

PDB Entry: 1ln6 (more details)

PDB Description: structure of bovine rhodopsin (metarhodopsin ii)
PDB Compounds: (A:) rhodopsin

SCOPe Domain Sequences for d1ln6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ln6a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]}
laaymfllimlgfpinfltlyvtvqhkklrtplnyillnlavadlfmvfggftttlytsl
hgyfvfgptgcnlegffatlggeialwslvvlaieryvvvckpmsnfrfgenhaimgvaf
twvmalacaapplvgwsryipegmqcscgidyytpheetnnesfviymfvvhfiiplivi
ffcygqlvftvkeaaaqqqesattqkaekevtrmviimviaflicwlpyagvafyifthq
gsdfgpifmtipaffaktsavynpviyimmnkqfrncmvttlccgknplgddeasttvsk
tetsqvapa

SCOPe Domain Coordinates for d1ln6a_:

Click to download the PDB-style file with coordinates for d1ln6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ln6a_: