Lineage for d1lmza_ (1lmz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2329190Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2329191Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2329303Family a.96.1.4: 3-Methyladenine DNA glycosylase I (Tag) [74756] (1 protein)
    automatically mapped to Pfam PF03352
  6. 2329304Protein 3-Methyladenine DNA glycosylase I (Tag) [74757] (2 species)
  7. 2329305Species Escherichia coli [TaxId:562] [74758] (3 PDB entries)
  8. 2329307Domain d1lmza_: 1lmz A: [74037]

Details for d1lmza_

PDB Entry: 1lmz (more details)

PDB Description: Solution Structure of 3-Methyladenine DNA Glycosylase I (TAG)
PDB Compounds: (A:) 3-Methyladenine Dna Glycosylase I (TAG)

SCOPe Domain Sequences for d1lmza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmza_ a.96.1.4 (A:) 3-Methyladenine DNA glycosylase I (Tag) {Escherichia coli [TaxId: 562]}
mercgwvsqdplyiayhdnewgvpetdskklfemiclegqqaglswitvlkkrenyracf
hqfdpvkvaamqeedverlvqdagiirhrgkiqaiignaraylqmeqngepfadfvwsfv
nhqpqmtqattlseiptstpasdalskalkkrgfkfvgtticysfmqacglvndhvvgcc
cypgnkp

SCOPe Domain Coordinates for d1lmza_:

Click to download the PDB-style file with coordinates for d1lmza_.
(The format of our PDB-style files is described here.)

Timeline for d1lmza_: