Lineage for d1lkye_ (1lky E:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214550Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 214551Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 214552Family a.60.1.1: Pointed domain [47770] (2 proteins)
  6. 214556Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (1 species)
  7. 214557Species Human (Homo sapiens) [TaxId:9606] [74736] (2 PDB entries)
  8. 214565Domain d1lkye_: 1lky E: [73989]

Details for d1lkye_

PDB Entry: 1lky (more details), 2.3 Å

PDB Description: structure of the wild-type tel-sam polymer

SCOP Domain Sequences for d1lkye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkye_ a.60.1.1 (E:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens)}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
phsgdrlyellqhilkq

SCOP Domain Coordinates for d1lkye_:

Click to download the PDB-style file with coordinates for d1lkye_.
(The format of our PDB-style files is described here.)

Timeline for d1lkye_: