Lineage for d1le6a_ (1le6 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2345962Protein Phospholipase A2 [48637] (5 species)
  7. 2345999Species Human (Homo sapiens), SPLA2 [TaxId:9606] [74797] (5 PDB entries)
    group X secretory phospholipase A2
  8. 2346000Domain d1le6a_: 1le6 A: [73862]
    complexed with ca, mpd

Details for d1le6a_

PDB Entry: 1le6 (more details), 1.97 Å

PDB Description: carboxylic ester hydrolase, p 1 21 1 space group
PDB Compounds: (A:) Group X Secretory Phospholipase A2

SCOPe Domain Sequences for d1le6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le6a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]}
gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
kcd

SCOPe Domain Coordinates for d1le6a_:

Click to download the PDB-style file with coordinates for d1le6a_.
(The format of our PDB-style files is described here.)

Timeline for d1le6a_: