Lineage for d1lbzb_ (1lbz B:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055431Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 1055432Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 1055433Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 1055442Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (4 species)
  7. 1055443Species Archaeoglobus fulgidus [TaxId:2234] [75608] (5 PDB entries)
  8. 1055451Domain d1lbzb_: 1lbz B: [73822]
    complexed with ca, fbp

Details for d1lbzb_

PDB Entry: 1lbz (more details), 2.2 Å

PDB Description: crystal structure of a complex (p32 crystal form) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with 3 calcium ions and fructose-1,6 bisphosphate
PDB Compounds: (B:) fructose 1,6-bisphosphatase/inositol monophosphatase

SCOPe Domain Sequences for d1lbzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbzb_ e.7.1.1 (B:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeoglobus fulgidus [TaxId: 2234]}
mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
eklhpkllelik

SCOPe Domain Coordinates for d1lbzb_:

Click to download the PDB-style file with coordinates for d1lbzb_.
(The format of our PDB-style files is described here.)

Timeline for d1lbzb_: